SLC6A18 Rabbit Polyclonal Antibody

SKU: orb579072

Description

SLC6A18 Rabbit Polyclonal Antibody is an unconjugated, Protein A purified antibody for the detection of SLC6A18. It is suitable for IHC, WB applications. The immunogen is a synthetic peptide directed towards the middle region of human SLC6A18. This antibody reacts with Human samples and is predicted to react with Bovine, Canine, Equine, Mouse, Porcine, Rat. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Neuroscience

Images & Validation

• Tested Applications: IHC, WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Mouse, Porcine, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SLC6A18
• Target: SLC6A18
• Protein Sequence: Synthetic peptide located within the following region: MHLNATWPKRVAQLPLKACLLEDFLDKSASGPGLAFVVFTETDLHMPGAP
• Molecular Weight: 69kDa
• Purification: Protein A purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

Xtrp2

Quick Database Links

Gene Symbol

SLC6A18

UniProt

Q96N87

RefSeq (Protein):NP_872438