SLC47A2 Rabbit Polyclonal Antibody

• Catalog Number: orb330650
• Category: Antibodies
• Description: Rabbit polyclonal antibody to SLC47A2
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Canine, Equine
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human SLC47A2
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 65 kDa
• Target: SLC47A2
• UniProt ID: Q86VL8
• Protein Sequence: Synthetic peptide located within the following region: TYSRSECHVDFFRTPEEAHALSAPTSRLSVKQLVIRRGAALGAASATLMV
• NCBI: NP_001093116
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti FLJ31196 antibody, anti MATE2 antibody, anti
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. Multiple isoforms between 61 kDa and 67 kDa contain the peptide sequence.

Sample Tissue: Human Liver Tumor, Antibody dilution: 3 ug/ml.

Sample Tissue: Human THP-1 Whole Cell, Antibody dilution: 3 ug/ml.

WB Suggested Anti-SLC47A2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:2500, Positive Control: Human Lung.