Cart summary

You have no items in your shopping cart.

SLC39A6 Rabbit Polyclonal Antibody

SKU: orb578987

Description

Rabbit polyclonal antibody to SLC39A6

Research Area

Epigenetics & Chromatin, Stem Cell & Developmental Biology

Images & Validation

Tested ApplicationsIHC, WB
ReactivityHuman
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Sheep

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human SLC39A6
TargetSLC39A6
Protein SequenceSynthetic peptide located within the following region: RSCLIHTSEKKAEIPPKTYSLQIAWVGGFIAISIISFLSLLGVILVPLMN
Molecular Weight85 kDa
PurificationProtein A purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration1.0 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

ZIP6, LIV-1

Similar Products

  • SLC39A6 Antibody [orb395273]

    ELISA,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg, 50 μg
  • SLC39A6 Rabbit Polyclonal Antibody [orb2954916]

    ELISA,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg, 50 μg
  • SLC39A6 Rabbit Polyclonal Antibody (HRP) [orb2120006]

    IHC,  WB

    Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep

    Rabbit

    Polyclonal

    HRP

    100 μl
  • SLC39A6 Rabbit Polyclonal Antibody (FITC) [orb2120007]

    IHC,  WB

    Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep

    Rabbit

    Polyclonal

    FITC

    100 μl
  • SLC39A6 Rabbit Polyclonal Antibody (Biotin) [orb2120008]

    IHC,  WB

    Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep

    Rabbit

    Polyclonal

    Biotin

    100 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

SLC39A6 Rabbit Polyclonal Antibody

25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. The peptide is present in isoforms of 85 kDa and 49 kDa and the protein may be modified by phosphorylation and/or glycosylation. The canonical 85 kDa isoform was undetectable in these samples.

SLC39A6 Rabbit Polyclonal Antibody

Sample Type: 293T, Antibody Dilution: 1.0 ug/ml. SLC39A6 is strongly supported by BioGPS gene expression data to be expressed in HEK293T.

SLC39A6 Rabbit Polyclonal Antibody

Sample Type: Human Fetal Brain, Antibody Dilution: 1.0 ug/ml.

SLC39A6 Rabbit Polyclonal Antibody

Sample Type: MCF7, Antibody Dilution: 1.0 ug/ml. SLC39A6 is strongly supported by BioGPS gene expression data to be expressed in MCF7.

SLC39A6 Rabbit Polyclonal Antibody

Sample Type: 721_B, Antibody Dilution: 1.0 ug/ml. SLC39A6 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells.

SLC39A6 Rabbit Polyclonal Antibody

Human kidney

SLC39A6 Rabbit Polyclonal Antibody

WB Suggested Anti-SLC39A6 Antibody Titration: 1.25 ug/ml, Positive Control: Jurkat cell lysate.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol

SLC39A6 Rabbit Polyclonal Antibody (orb578987)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 530.00
DispatchUsually dispatched within 3-7 working days
Bulk Enquiry