You have no items in your shopping cart.
You have no items in your shopping cart.
| Catalog Number | orb330368 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to SLC39A5 |
| Target | SLC39A5 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human SLC39A5 |
| Protein Sequence | Synthetic peptide located within the following region: MGSPVSHLLAGFCVWVVLGWVGGSVPNLGPAEQEQNHYLAQLFGLYGENG |
| UniProt ID | Q6ZMH5 |
| MW | 56kDa |
| Tested applications | IHC, WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | anti LZT-Hs7 antibody, anti MGC34778 antibody, ant Read more... |
| Research Area | Cell Biology, Immunology & Inflammation, Signal Tr Read more... |
| Note | For research use only |
| NCBI | NP_775867 |

Sample Tissue: Human Jurkat Whole Cell, Antibody Dilution: 1 ug/mL.

Human Liver

Rabbit Anti-SLC39A5 antibody, Formalin Fixed Paraffin Embedded Tissue: Human Colon, Primary antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20x, Exposure Time: 0.5-2.0 sec.

Rabbit Anti-SLC39A5 antibody, Formalin Fixed Paraffin Embedded Tissue: Human Prostate, Primary antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20x, Exposure Time: 0.5-2.0 sec.

Rabbit Anti-SLC39A5 antibody, Formalin Fixed Paraffin Embedded Tissue: Human Uterus, Primary antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20x, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-SLC39A5 Antibody Titration: 0.5 ug/mL, Positive Control: HepG2 cell lysate.
IHC, WB | |
Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
ICC, IF | |
Bovine, Canine, Equine, Feline, Guinea pig, Human, Mouse, Rabbit, Rat | |
Rabbit | |
Polyclonal | |
FITC |
ICC, IF | |
Bovine, Canine, Equine, Feline, Guinea pig, Human, Mouse, Rabbit, Rat | |
Rabbit | |
Polyclonal | |
Cy5.5 |
ICC, IF | |
Bovine, Canine, Equine, Feline, Guinea pig, Human, Mouse, Rabbit, Rat | |
Rabbit | |
Polyclonal | |
Cy7 |
ICC, IF | |
Bovine, Canine, Equine, Feline, Guinea pig, Human, Mouse, Rabbit, Rat | |
Rabbit | |
Polyclonal | |
RBITC |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review