SLC39A5 Rabbit Polyclonal Antibody

• Catalog Number: orb330369
• Category: Antibodies
• Description: Rabbit polyclonal antibody to SLC39A5
• Target: SLC39A5
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SLC39A5
• Protein Sequence: Synthetic peptide located within the following region: HYLAQLFGLYGENGTLTAGGLARLLHSLGLGRVQGLRLGQHGPLTGRAAS
• UniProt ID: Q6ZMH5
• MW: 56kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti LZT-Hs7 antibody, anti MGC34778 antibody, ant
• Research Area: Cell Biology, Immunology & Inflammation, Signal Tr
• Note: For research use only
• NCBI: NP_775867

Immunohistochemistry with Human Pancrease lysate tissue at an antibody concentration of 5.0 ug/mL using anti-SLC39A5 antibody (orb330369).

WB Suggested Anti-SLC39A5 Antibody Titration: 1 ug/mL, Positive Control: Placenta.