You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb589181 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to SLC39A13 |
Target | SLC39A13 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Human |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human SLC39A13 |
Protein Sequence | Synthetic peptide located within the following region: WVIAGILTFLALEKMFLDSKEEGTSQAPNKDPTAAAAALNGGHCLAQPAA |
UniProt ID | Q96H72 |
MW | 40 kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | ZIP13, SCDEDS, EDSSPD3, LZT-Hs9 |
Note | For research use only |
NCBI | NP_001121697.1 |
Sample Tissue: Human U937 Whole Cell lysates, Antibody Dilution: 1 ug/ml.
WB | |
Human | |
Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, ICC, IF, IHC-Fr, IHC-P, WB | |
Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, WB | |
Mouse, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |