You have no items in your shopping cart.
SLC38A3 Rabbit Polyclonal Antibody
Description
Research Area
Images & Validation
−| Tested Applications | IHC, WB |
|---|---|
| Reactivity | Human, Mouse |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Porcine, Rabbit, Rat, Sheep |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human SLC38A3 |
| Target | SLC38A3 |
| Protein Sequence | Synthetic peptide located within the following region: GNQRVEDPARSCMEGKSFLQKSPSKEPHFTDFEGKTSFGMSVFNLSNAIM |
| Molecular Weight | 56 kDa |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−SLC38A3 Rabbit Polyclonal Antibody [orb631274]
ELISA, FC, IHC, IP, WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
50 μg, 100 μgSLC38A3 Rabbit Polyclonal Antibody [orb668162]
WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
50 μl, 200 μl, 100 μl, 30 μlSLC38A3 Rabbit Polyclonal Antibody (HRP) [orb2122400]
IHC, WB
Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep
Rabbit
Polyclonal
HRP
100 μl

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment.

Primary Antibody Dilution: 1:200, Secondary Antibody: Goat anti-rabbit Alexafluor 568, Secondary Antibody Dilution: 1:200, Color/Signal Descriptions: SLC38A3: Red CtBp: Green DAPI: Blue, Gene Name: SLC38A3.

Primary Antibody Dilution: 1:200, Secondary Antibody: Goat anti-rabbit Alexafluor 568, Secondary Antibody Dilution: 1:200, Color/Signal Descriptions: SLC38A3: Red CtBp: Green DAPI: Blue, Gene Name: SLC38A3.

Rabbit Anti-SLC38A3 antibody, Formalin Fixed Paraffin Embedded Tissue: Human Colon, Submucosal Plexus, Primary antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20x, Exposure Time: 0.5-2.0 sec.

Rabbit Anti-SLC38A3 antibody, Formalin Fixed Paraffin Embedded Tissue: Human Placenta, Primary antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20x, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-SLC38A3 Antibody Titration: 0.2-1 ug/ml, Positive Control: HepG2 cell lysate. SLC38A3 is supported by BioGPS gene expression data to be expressed in HepG2.
Documents Download
Request a Document
Protocol Information
SLC38A3 Rabbit Polyclonal Antibody (orb578426)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review







