Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

SLC38A3 Rabbit Polyclonal Antibody

SKU: orb578426

Description

Rabbit polyclonal antibody to SLC38A3

Research Area

Cell Biology

Images & Validation

Tested ApplicationsIHC, WB
ReactivityHuman, Mouse
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Porcine, Rabbit, Rat, Sheep

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human SLC38A3
TargetSLC38A3
Protein SequenceSynthetic peptide located within the following region: GNQRVEDPARSCMEGKSFLQKSPSKEPHFTDFEGKTSFGMSVFNLSNAIM
Molecular Weight56 kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

G17, SN1, NAT1, SNAT3

Similar Products

  • SLC38A3 Rabbit Polyclonal Antibody [orb631274]

    ELISA,  FC,  IHC,  IP,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μg, 100 μg
  • SLC38A3 Rabbit Polyclonal Antibody [orb668162]

    WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 200 μl, 100 μl, 30 μl
  • SLC38A3 Antibody (Center) [orb37057]

    FC,  WB

    Human

    Rabbit

    Polyclonal

    Unconjugated

    400 μl
  • SLC38A3 Rabbit Polyclonal Antibody (HRP) [orb2122400]

    IHC,  WB

    Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep

    Rabbit

    Polyclonal

    HRP

    100 μl
  • SLC38A3 Rabbit Polyclonal Antibody (FITC) [orb2122401]

    IHC,  WB

    Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep

    Rabbit

    Polyclonal

    FITC

    100 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

SLC38A3 Rabbit Polyclonal Antibody

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment.

SLC38A3 Rabbit Polyclonal Antibody

Primary Antibody Dilution: 1:200, Secondary Antibody: Goat anti-rabbit Alexafluor 568, Secondary Antibody Dilution: 1:200, Color/Signal Descriptions: SLC38A3: Red CtBp: Green DAPI: Blue, Gene Name: SLC38A3.

SLC38A3 Rabbit Polyclonal Antibody

Primary Antibody Dilution: 1:200, Secondary Antibody: Goat anti-rabbit Alexafluor 568, Secondary Antibody Dilution: 1:200, Color/Signal Descriptions: SLC38A3: Red CtBp: Green DAPI: Blue, Gene Name: SLC38A3.

SLC38A3 Rabbit Polyclonal Antibody

Rabbit Anti-SLC38A3 antibody, Formalin Fixed Paraffin Embedded Tissue: Human Colon, Submucosal Plexus, Primary antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20x, Exposure Time: 0.5-2.0 sec.

SLC38A3 Rabbit Polyclonal Antibody

Rabbit Anti-SLC38A3 antibody, Formalin Fixed Paraffin Embedded Tissue: Human Placenta, Primary antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20x, Exposure Time: 0.5-2.0 sec.

SLC38A3 Rabbit Polyclonal Antibody

WB Suggested Anti-SLC38A3 Antibody Titration: 0.2-1 ug/ml, Positive Control: HepG2 cell lysate. SLC38A3 is supported by BioGPS gene expression data to be expressed in HepG2.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_006832

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol

SLC38A3 Rabbit Polyclonal Antibody (orb578426)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 600.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 3-7 working days
Bulk Enquiry