You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb578426 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to SLC38A3 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Porcine, Rabbit, Rat, Sheep |
Reactivity | Human, Mouse |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human SLC38A3 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 56 kDa |
Target | SLC38A3 |
UniProt ID | Q99624 |
Protein Sequence | Synthetic peptide located within the following region: GNQRVEDPARSCMEGKSFLQKSPSKEPHFTDFEGKTSFGMSVFNLSNAIM |
NCBI | NP_006832 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | G17, SN1, NAT1, SNAT3 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment.
Primary Antibody Dilution: 1:200, Secondary Antibody: Goat anti-rabbit Alexafluor 568, Secondary Antibody Dilution: 1:200, Color/Signal Descriptions: SLC38A3: Red CtBp: Green DAPI: Blue, Gene Name: SLC38A3.
Primary Antibody Dilution: 1:200, Secondary Antibody: Goat anti-rabbit Alexafluor 568, Secondary Antibody Dilution: 1:200, Color/Signal Descriptions: SLC38A3: Red CtBp: Green DAPI: Blue, Gene Name: SLC38A3.
Rabbit Anti-SLC38A3 antibody, Formalin Fixed Paraffin Embedded Tissue: Human Colon, Submucosal Plexus, Primary antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20x, Exposure Time: 0.5-2.0 sec.
Rabbit Anti-SLC38A3 antibody, Formalin Fixed Paraffin Embedded Tissue: Human Placenta, Primary antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20x, Exposure Time: 0.5-2.0 sec.
WB Suggested Anti-SLC38A3 Antibody Titration: 0.2-1 ug/ml, Positive Control: HepG2 cell lysate. SLC38A3 is supported by BioGPS gene expression data to be expressed in HepG2.
ELISA, FC, IHC, IP, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC, WB | |
Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep | |
Rabbit | |
Polyclonal | |
HRP |
IHC, WB | |
Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep | |
Rabbit | |
Polyclonal | |
FITC |