You have no items in your shopping cart.
SLC38A2 Rabbit Polyclonal Antibody
Description
Research Area
Images & Validation
−| Tested Applications | WB |
|---|---|
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human SLC38A2 |
| Target | SLC38A2 |
| Protein Sequence | Synthetic peptide located within the following region: AALKSHYADVDPENQNFLLESNLGKKKYETEFHPGTTSFGMSVFNLSNAI |
| Molecular Weight | 56 kDa |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−SNAT2 rabbit pAb Antibody [orb769527]
ELISA, IHC, WB
Human, Mouse, Rat
Polyclonal
Unconjugated
100 μl, 50 μlSLC38A2 Rabbit Polyclonal Antibody [orb158407]
WB
Bovine, Canine, Equine, Human, Porcine, Sheep
Mouse, Rat
Rabbit
Polyclonal
Unconjugated
50 μl, 100 μl, 200 μlSNAT2 polyclonal antibody [orb670070]
WB
Human, Mouse
Rabbit
Polyclonal
Unconjugated
200 μl, 100 μl, 50 μlSLC38A2 Rabbit Polyclonal Antibody (Biotin) [orb2137949]
WB
Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat
Rabbit
Polyclonal
Biotin
100 μl

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. Protein has two closely sized isoforms and can be glycosylated.

Sample Tissue: Human HepG2, Antibody dilution: 1.0 ug/ml.

Sample Tissue: Human OVCAR-3 Whole Cell, Antibody dilution: 1 ug/ml.

Sample Tissue: Human THP-1 Whole Cell, Antibody dilution: 1 ug/ml.

WB Suggested Anti-SLC38A2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: HT1080 cell lysate, SLC38A2 is strongly supported by BioGPS gene expression data to be expressed in Human HT1080 cells.
Documents Download
Request a Document
SLC38A2 Rabbit Polyclonal Antibody (orb574492)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review



