You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb578938 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to SLC38A1 |
Target | SLC38A1 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 1.0 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human SLC38A1 |
Protein Sequence | Synthetic peptide located within the following region: DRSQKKMQMVSNISFFAMFVMYFLTAIFGYLTFYDNVQSDLLHKYQSKDD |
UniProt ID | Q9H2H9 |
MW | 54 kDa |
Tested applications | IHC, WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | ATA1, NAT2, SAT1, SNAT1 |
Note | For research use only |
NCBI | NP_001070952 |
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 7 ug/ml of the antibody was used in this experiment.
Human kidney
WB Suggested Anti-SLC38A1 Antibody Titration: 2.5 ug/ml, Positive Control: HepG2 cell lysate. SLC38A1 is supported by BioGPS gene expression data to be expressed in HepG2.
IHC, WB | |
Bovine, Canine, Equine, Guinea pig, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IHC, IP, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Feline, Guinea pig, Human, Porcine | |
Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Feline, Guinea pig, Human, Porcine | |
Mouse, Rat | |
Rabbit | |
Polyclonal | |
Biotin |
WB | |
Bovine, Feline, Guinea pig, Human, Porcine | |
Mouse, Rat | |
Rabbit | |
Polyclonal | |
AP |