Cart summary

You have no items in your shopping cart.

Slc37a2 Rabbit Polyclonal Antibody (Biotin)

Slc37a2 Rabbit Polyclonal Antibody (Biotin)

Catalog Number: orb2119609

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2119609
CategoryAntibodies
DescriptionSlc37a2 Rabbit Polyclonal Antibody (Biotin)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsWB
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish
ImmunogenThe immunogen is a synthetic peptide corresponding to a region of Mouse
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationBiotin
MW55kDa
UniProt IDQ9WU81
Protein SequenceSynthetic peptide located within the following region: FSLCLLFAKLVSYTFLYWLPLYIFNVAHFSAKEAGDLSTLFDVGGIIGGI
NCBINP_064654
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
Alternative namesG3, ci, cI-, ci2, G3PP, Slc3, cI-2, Slc37a1
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.