Cart summary

You have no items in your shopping cart.

SLC35E2B Rabbit Polyclonal Antibody (FITC)

SLC35E2B Rabbit Polyclonal Antibody (FITC)

Catalog Number: orb2084655

Select Product Size
SizePriceQuantity
100 μl$ 0.00
100 μl Enquire
DispatchUsually dispatched within 5-10 working days
Product Properties
Catalog Numberorb2084655
CategoryAntibodies
DescriptionSLC35E2B Rabbit Polyclonal Antibody (FITC)
ClonalityPolyclonal
Species/HostRabbit
ConjugationFITC
Predicted ReactivityCanine, Human
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
PurificationAffinity Purified
ImmunogenThe immunogen is a synthetic peptide directed towards the N-terminal region of Human SLC35E2B
Protein SequenceSynthetic peptide located within the following region: SVKTPALEELVPGSEEKPKGRSPLSWGSLFGHRSEKIVFAKSDGGTDENV
UniProt IDP0CK96
MW44kDa
Tested applicationsWB
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Alternative namesSLC35E2
NoteFor research use only
NCBINP_001104251
Images
Reviews

SLC35E2B Rabbit Polyclonal Antibody (FITC) (orb2084655)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet