Cart summary

You have no items in your shopping cart.

SLC34A3 Rabbit Polyclonal Antibody (FITC)

SLC34A3 Rabbit Polyclonal Antibody (FITC)

Catalog Number: orb2141167

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2141167
CategoryAntibodies
DescriptionSLC34A3 Rabbit Polyclonal Antibody (FITC)
ClonalityPolyclonal
Species/HostRabbit
ConjugationFITC
Predicted ReactivityCanine, Human, Mouse, Rat
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human SLC34A3
Protein SequenceSynthetic peptide located within the following region: LLERLSELALGAASLTPRAQAPDILKVLTKPLTHLIVQLDSDMIMSSATG
UniProt IDQ8N130
MW63kDa
Tested applicationsWB
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Alternative namesHHRH, NPTIIc
NoteFor research use only
NCBINP_543153
Expiration Date12 months from date of receipt.