You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb576348 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to Slc2a12 |
Target | Slc2a12 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Mouse |
Predicted Reactivity | Bovine, Canine, Equine, Goat, Human, Porcine, Rabbit, Rat |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide corresponding to a region of Mouse |
Protein Sequence | Synthetic peptide located within the following region: VLFIPETKGCSLEQISVELAKANYVKNNICFMSHHQEELVPTQLQKRKPQ |
UniProt ID | Q8BFW9 |
MW | 67kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | Glut1, GLUT-1, Glut12, GLUT-12 |
Note | For research use only |
NCBI | NP_849265 |
WB Suggested Anti-Slc2a12 Antibody Titration: 0.2-1 ug/ml, Positive Control: Mouse Spleen.
FC, ICC, IF, IHC-Fr, IHC-P, WB | |
Bovine, Canine, Equine, Gallus, Guinea pig, Porcine, Rabbit | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
FC, ICC, IF | |
Bovine, Canine, Equine, Gallus, Guinea pig, Porcine, Rabbit | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
PE |
WB | |
Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Porcine, Rabbit, Rat, Zebrafish | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
FC, ICC, IF | |
Bovine, Canine, Equine, Gallus, Guinea pig, Porcine, Rabbit | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Cy3 |
IHC-Fr, IHC-P, WB | |
Bovine, Canine, Equine, Gallus, Guinea pig, Porcine, Rabbit | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
HRP |