SLC27A2 Rabbit Polyclonal Antibody

• Catalog Number: orb578965
• Category: Antibodies
• Description: Rabbit polyclonal antibody to SLC27A2
• Target: SLC27A2
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SLC27A2
• Protein Sequence: Synthetic peptide located within the following region: LLFRDETLTYAQVDRRSNQVARALHDHLGLRQGDCVALLMGNEPAYVWLW
• UniProt ID: O14975
• MW: 70 kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: VLCS, FATP2, VLACS, ACSVL1, FACVL1, hFACVL1, HsT17
• Note: For research use only
• NCBI: NP_003636

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. Canonical 70 kDa isoform is identified, and a second isoform of 65 kDa is also present in some samples.

Sample Type: Hela, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1 ug/ml, Peptide Concentration: 5.0 ug/ml, Lysate Quantity: 25 ug/lane/lane, Gel Concentration: 12%. SLC27A2 is strongly supported by BioGPS gene expression data to be expressed in Human HeLa cells.

Positive control (+): Hela (HL), Negative control (-): Human lung (LU), Antibody concentration: 1 ug/ml.

Liver, Human: Formalin-Fixed, Paraffin-Embedded (FFPE).

Liver, Human: Formalin-Fixed, Paraffin-Embedded (FFPE).

WB Suggested Anti-SLC27A2 Antibody Titration: 1 ug/ml, Positive Control: Hela cell lysate.

WB Suggested Anti-SLC27A2 Antibody Titration: 1 ug/ml, Positive Control: Jurkat lysate.

WB Suggested Anti-SLC27A2 antibody Titration: 1 ug/ml, Sample Type: Human MCF7.

WB Suggested Anti-SLC27A2 antibody Titration: 1 ug/ml, Sample Type: Human PANC1.