You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb330364 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to SLC26A8 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Human |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human SLC26A8 |
Concentration | 1.0 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 61kDa |
Target | SLC26A8 |
UniProt ID | Q5JVR5 |
Protein Sequence | Synthetic peptide located within the following region: EPQPETEPEMEPNPKSRPRAHTFPQQRYWPMYHPSMASTQSQTQTRTWSV |
NCBI | CAI40882 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti RP11-482O9.1 antibody, anti FLJ32714 antibody Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Human Brain
WB Suggested Anti-SLC26A8 Antibody Titration: 5.0 ug/mL, Positive Control: Jurkat cell lysate.
WB | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |