You have no items in your shopping cart.
Cart summary
Item 1 of 2
Item 1 of 2
SLC26A8 Rabbit Polyclonal Antibody
Catalog Number: orb330363
| Catalog Number | orb330363 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to SLC26A8 |
| Species/Host | Rabbit |
| Clonality | Polyclonal |
| Tested applications | WB |
| Predicted Reactivity | Human |
| Reactivity | Human |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of Human SLC26A8 |
| Concentration | 0.5 mg/ml |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Conjugation | Unconjugated |
| MW | 109 kDa |
| Target | SLC26A8 |
| UniProt ID | Q96RN1 |
| Protein Sequence | Synthetic peptide located within the following region: VPYTVSSVSQKNQGQQYEEVEEVWLPNNSSRNSSPGLPDVAESQGRRSLI |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Alternative names | TAT1, SPGF3 Read more... |
| Note | For research use only |
| Expiration Date | 12 months from date of receipt. |
25 ug of the indicated Human whole cell extracts was loaded onto a 6-18% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment.
Sample Type: 293T Whole Cell lysates, Antibody Dilution: 1.0 ug/mL.
- Item 1 of 3
- Item 1 of 2
- Item 1 of 2
SLC26A8 Rabbit Polyclonal Antibody [orb317932]
WB
Human
Rabbit
Polyclonal
Unconjugated
100 μl, 50 μl, 200 μl 
