You have no items in your shopping cart.
Description
Research Area
Images & Validation
−| Tested Applications | IHC, WB |
|---|---|
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human SLC26A4 |
| Target | SLC26A4 |
| Protein Sequence | Synthetic peptide located within the following region: ELNDRFRHKIPVPIPIEVIVTIIATAISYGANLEKNYNAGIVKSIPRGFL |
| Molecular Weight | 86 kDa |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−SLC26A4 Polyclonal Antibody [orb3150733]
ELISA, IHC, WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
50 μg, 100 μgSLC26A4 Rabbit Polyclonal Antibody [orb413018]
WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
100 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. The canonical isoform of 86 kDa is present as well as a second isoform around 39 kDa.

Sample Tissue: Human 786-0 Whole Cell, Antibody Dilution: 1 ug/ml.

Sample Tissue: Human 786-0 Whole Cell, Antibody Dilution: 3 ug/ml.

Sample Tissue: Human 786-0 Whole Cell, Antibody Dilution: 3 ug/ml.

Sample Tissue: Human Hela Whole Cell, Antibody Dilution: 3 ug/ml.

Sample Tissue: Human Ovary Tumor, Antibody Dilution: 1 ug/ml.

Immunohistochemistry with Placenta tissue at an antibody concentration of 5 ug/ml using anti-SLC26A4 antibody (orb578191).

WB Suggested Anti-SLC26A4 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: COLO205 cell lysate.
Documents Download
Request a Document
Protocol Information
SLC26A4 Rabbit Polyclonal Antibody (orb578191)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review

