SLC26A4 Rabbit Polyclonal Antibody

• Catalog Number: orb578191
• Category: Antibodies
• Description: Rabbit polyclonal antibody to SLC26A4
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SLC26A4
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 86 kDa
• Target: SLC26A4
• UniProt ID: O43511
• Protein Sequence: Synthetic peptide located within the following region: ELNDRFRHKIPVPIPIEVIVTIIATAISYGANLEKNYNAGIVKSIPRGFL
• NCBI: NP_000432
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: EVA, PDS, DFNB4, TDH2B
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. The canonical isoform of 86 kDa is present as well as a second isoform around 39 kDa.

Sample Tissue: Human 786-0 Whole Cell, Antibody Dilution: 1 ug/ml.

Sample Tissue: Human 786-0 Whole Cell, Antibody Dilution: 3 ug/ml.

Sample Tissue: Human 786-0 Whole Cell, Antibody Dilution: 3 ug/ml.

Sample Tissue: Human Hela Whole Cell, Antibody Dilution: 3 ug/ml.

Sample Tissue: Human Ovary Tumor, Antibody Dilution: 1 ug/ml.

Immunohistochemistry with Placenta tissue at an antibody concentration of 5 ug/ml using anti-SLC26A4 antibody (orb578191).

WB Suggested Anti-SLC26A4 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: COLO205 cell lysate.