Cart summary

You have no items in your shopping cart.

SLC26A3 Rabbit Polyclonal Antibody (Biotin)

SLC26A3 Rabbit Polyclonal Antibody (Biotin)

Catalog Number: orb2142835

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2142835
CategoryAntibodies
DescriptionSLC26A3 Rabbit Polyclonal Antibody (Biotin)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsIHC, WB
Predicted ReactivityBovine, Canine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human SLC26A3
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationBiotin
MW84kDa
UniProt IDP40879
Protein SequenceSynthetic peptide located within the following region: DAVLHILMKKDYSTSKFNPSQEKDGKIDFTINTNGGLRNRVYEVPVETKF
NCBINP_000102
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
Alternative namesCLD, DRA
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.