Cart summary

You have no items in your shopping cart.

    SLC25A6 Antibody - N-terminal region : Biotin

    SLC25A6 Antibody - N-terminal region : Biotin

    Catalog Number: orb2099926

    DispatchUsually dispatched within 5-10 working days
    $ 632.00
    Catalog Numberorb2099926
    CategoryAntibodies
    DescriptionSLC25A6 Antibody - N-terminal region : Biotin
    Species/HostRabbit
    ClonalityPolyclonal
    Tested applicationsWB
    ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human SLC25A6
    Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
    ConjugationBiotin
    MW33kDa
    UniProt IDQ6QRN9
    Protein SequenceSynthetic peptide located within the following region: LQVQHASKQIAADKQYKGIVDCIVRIPKEQGVLSFWRGNLANVIRYFPTQ
    NCBINP_001627
    StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
    Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
    Alternative namesANT, AAC3, ANT3, ANT 2, ANT 3, ANT3Y
    Read more...
    NoteFor research use only
    Expiration Date12 months from date of receipt.
    Submit a review

    Filter by Rating

      • Star
      • Star
      • Star
      • Star
      • Star
      • 5 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 4 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 3 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 2 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 1 stars