You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb578940 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to SLC25A4 |
Target | SLC25A4 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human, Rat |
Predicted Reactivity | Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Rabbit, Sheep, Zebrafish |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human SLC25A4 |
Protein Sequence | Synthetic peptide located within the following region: LLQVQHASKQISAEKQYKGIIDCVVRIPKEQGFLSFWRGNLANVIRYFPT |
UniProt ID | Q05962 |
MW | 33 kDa |
Tested applications | IHC, WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | T1, ANT, AAC1, ANT1, PEO2, PEO3, ANT 1, PEOA2, MTD Read more... |
Note | For research use only |
NCBI | NP_001142 |
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. A smaller isoform may also be identified with this antibody at 22 kDa.
Sample Tissue: Human A549 Whole Cell, Antibody Dilution: 1 ug/ml.
Sample Tissue: Human DLD1 Whole Cell, Antibody Dilution: 1 ug/ml.
Sample Tissue: Human Ovary Tumor, Antibody Dilution: 1 ug/ml.
Sample Tissue: Human RPMI-8226, Antibody Dilution: 1.0 ug/ml.
Sample Tissue: Rat Skeletal Muscle, Antibody Dilution: 1 ug/ml.
Positive control (+): MCF7 (N10), Negative control (-): A549 (N03), Antibody concentration: 1 ug/ml.
Sample Tissue: Rat Skeletal Muscle, Antibody Dilution: 1 ug/ml.
Rabbit Anti-SLC25A4 Antibody, Catalog Number: orb578940, Formalin Fixed Paraffin Embedded Tissue: Human Pineal Tissue, Observed Staining: Cytoplasmic in cell bodies of pinealocytes and their processes, Primary Antibody Concentration: 1:100, Other Working Concentrations: 1/600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.
WB Suggested Anti-SLC25A4 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: RPMI 8226 cell lysate. SLC25A4 is supported by BioGPS gene expression data to be expressed in RPMI 8226.
IF, IHC-Fr, IHC-P | |
Bovine, Canine, Mouse, Porcine, Rabbit, Rat, Sheep | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IF, IHC-Fr, IHC-P | |
Porcine, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |