You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb584705 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to SLC25A33 |
Target | SLC25A33 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Sheep |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Protein Sequence | Synthetic peptide located within the following region: MNPIWMVKTRMQLEQKVRGSKQMNTLQCARYVYQTEGIRGFYRGLTASYA |
UniProt ID | Q9BSK2 |
MW | 35kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | PNC1, BMSC-MCP |
Note | For research use only |
NCBI | NP_115691 |
WB Suggested Anti-SLC25A33 Antibody, Titration: 1.0 ug/ml, Positive Control: ACHN Whole Cell.
IF, IHC-Fr, IHC-P | |
Equine, Human, Porcine, Rabbit | |
Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF | |
Equine, Human, Porcine, Rabbit | |
Mouse, Rat | |
Rabbit | |
Polyclonal | |
Cy5.5 |