SLC25A28 Rabbit Polyclonal Antibody

SKU: orb325124

Description

Rabbit polyclonal antibody to SLC25A28

Research Area

Cell Biology, Immunology & Inflammation, Signal Transduction, Stem Cell & Developmental Biology

Images & Validation

• Tested Applications: IHC, WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human SLC25A28
• Target: SLC25A28
• Protein Sequence: Synthetic peptide located within the following region: NTQESLALNSHITGHITGMASAFRTVYQVGGVTAYFRGVQARVIYQIPST
• Molecular Weight: 39 kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti DKFZp547C109 antibody, anti MFRN2 antibody, anti MRS3/4 antibody, anti MRS4L antibody, anti NPD016 antibody

Positive control (+): Human stomach (ST), Negative control (-): HepG2 (HG), Antibody concentration: 1 ug/mL.

Immunohistochemistry with Human kidney lysate tissue at an antibody concentration of 5.0 ug/mL using anti-SLC25A28 antibody (orb325124).

Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/mL in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.

WB Suggested Anti-SLC25A28 Antibody Titration: 1 ug/mL, Positive Control: MCF-7 Whole Cell lysates.

Quick Database Links

Gene Symbol

SLC25A28

UniProt

Q96A46

RefSeq (Protein):NP_112489