You have no items in your shopping cart.
You have no items in your shopping cart.
| Catalog Number | orb325124 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to SLC25A28 |
| Target | SLC25A28 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human SLC25A28 |
| Protein Sequence | Synthetic peptide located within the following region: NTQESLALNSHITGHITGMASAFRTVYQVGGVTAYFRGVQARVIYQIPST |
| UniProt ID | Q96A46 |
| MW | 39 kDa |
| Tested applications | IHC, WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | anti DKFZp547C109 antibody, anti MFRN2 antibody, a Read more... |
| Research Area | Cell Biology, Immunology & Inflammation, Signal Tr Read more... |
| Note | For research use only |
| NCBI | NP_112489 |

Positive control (+): Human stomach (ST), Negative control (-): HepG2 (HG), Antibody concentration: 1 ug/mL.

Immunohistochemistry with Human kidney lysate tissue at an antibody concentration of 5.0 ug/mL using anti-SLC25A28 antibody (orb325124).

Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/mL in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.

WB Suggested Anti-SLC25A28 Antibody Titration: 1 ug/mL, Positive Control: MCF-7 Whole Cell lysates.
WB | |
Bovine, Canine, Human, Porcine, Sheep | |
Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Human, Porcine, Sheep | |
Mouse, Rat | |
Rabbit | |
Polyclonal | |
Biotin |
WB | |
Bovine, Canine, Human, Porcine, Sheep | |
Mouse, Rat | |
Rabbit | |
Polyclonal | |
AP |
WB | |
Bovine, Canine, Human, Porcine, Sheep | |
Mouse, Rat | |
Rabbit | |
Polyclonal | |
HRP |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review