Cart summary

You have no items in your shopping cart.

SLC22A8 Rabbit Polyclonal Antibody (FITC)

SLC22A8 Rabbit Polyclonal Antibody (FITC)

Catalog Number: orb2123592

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2123592
CategoryAntibodies
DescriptionSLC22A8 Rabbit Polyclonal Antibody (FITC)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsWB
Predicted ReactivityBovine, Canine, Human, Mouse, Rabbit
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human SLC22A8
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationFITC
MW60kDa
UniProt IDQ8TCC7
Protein SequenceSynthetic peptide located within the following region: PETLNQPLPETIEDLENWSLRAKKPKQEPEVEKASQRIPLQPHGPGLGSS
NCBINP_004245
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
Alternative namesOAT3
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.