You have no items in your shopping cart.
SLC22A1 Rabbit Polyclonal Antibody
Description
Research Area
Images & Validation
−| Tested Applications | IHC, WB |
|---|---|
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human SLC22A1 |
| Target | SLC22A1 |
| Protein Sequence | Synthetic peptide located within the following region: LSCVDPLASLATNRSHLPLGPCQDGWVYDTPGSSIVTEFNLVCADSWKLD |
| Molecular Weight | 61kDa |
| Purification | Protein A purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 1.0 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−SLC22A1 Rabbit Polyclonal Antibody [orb317968]
WB
Human
Human, Mouse
Rabbit
Polyclonal
Unconjugated
50 μl, 200 μl, 100 μlSLC22A1 Rabbit Polyclonal Antibody [orb631234]
ELISA, WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
50 μg, 100 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 5 ug/ml of the antibody was used in this experiment. A 29 kDa SLC22A2 protein has a partial match and similarity to the immunizing peptide.

Sample Type: Jurkat, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 2.5 ug/ml, Peptide Concentration: 8.0 ug/ml, Lysate Quantity: 25 ug/lane, Gel Concentration: 12%.

Rabbit Anti-SLC22A1 Antibody, Paraffin Embedded Tissue: Human Intestine, Cellular Data: Epithelial cells of intestinal villas, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

WB Suggested Anti-SLC22A1 Antibody Titration: 2.5 ug/ml, Positive Control: Jurkat cell lysate.
Documents Download
Request a Document
Protocol Information
SLC22A1 Rabbit Polyclonal Antibody (orb578100)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review





