You have no items in your shopping cart.
SLC20A2 Rabbit Polyclonal Antibody
Description
Research Area
Images & Validation
−| Tested Applications | WB |
|---|---|
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human SLC20A2 |
| Target | SLC20A2 |
| Protein Sequence | Synthetic peptide located within the following region: DVNLYNETVETLMAGEVSAMVGSAVWQLIASFLRLPISGTHCIVGSTIGF |
| Molecular Weight | 70 kDa |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−SLC20A2 Rabbit Polyclonal Antibody [orb631233]
ELISA, IP, WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
50 μg, 100 μgSLC20A2 Rabbit Polyclonal Antibody [orb158401]
ELISA, ICC
Bovine, Equine, Gallus, Human, Porcine, Rabbit, Rat, Sheep
Mouse
Rabbit
Polyclonal
Unconjugated
50 μl, 100 μl, 200 μlSLC20A2 Rabbit Polyclonal Antibody (HRP) [orb2122406]
WB
Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish
Rabbit
Polyclonal
HRP
100 μl

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. Recommended dilution for this antibody is 1-3 ug/ml.

25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. An isoform present at 66 kDa contains the peptide sequence.

Sample Tissue: Human PANC1 Whole Cell, Antibody Dilution: 1 ug/ml.

WB Suggested Anti-SLC20A2 Antibody Titration: 0.2-1 ug/ml, Positive Control: HepG2 cell lysate.
Documents Download
Request a Document
SLC20A2 Rabbit Polyclonal Antibody (orb578424)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review




