SLC1A5 Rabbit Polyclonal Antibody

• Catalog Number: orb578398
• Category: Antibodies
• Description: Rabbit polyclonal antibody to SLC1A5
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish
• Reactivity: Bovine, Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SLC1A5
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 57 kDa
• Target: SLC1A5
• UniProt ID: Q71UA6
• Protein Sequence: Synthetic peptide located within the following region: FGVALRKLGPEGELLIRFFNSFNEATMVLVSWIMWYAPVGIMFLVAGKIV
• NCBI: NP_005619
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: R16, AAAT, ATBO, M7V1, RDRC, ASCT2, M7VS1
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 5 ug/ml of the antibody was used in this experiment. The canonical isoform of 56 kDa is present as well as a second isoform around 33-36 kDa.

Sample Tissue: Human 293T, Antibody Dilution: 1.0 ug/ml.

Positive control (+): 293T (2T), Negative control (-): Human liver (LI), Antibody concentration: 3 ug/ml.

Rabbit Anti-SLC1A5 Antibody, Paraffin Embedded Tissue: Human Kidney, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

WB Suggested Anti-SLC1A5 Antibody Titration: 2.5 ug/ml, Positive Control: Jurkat cell lysate. SLC1A5 is supported by BioGPS gene expression data to be expressed in Jurkat.