You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb578398 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to SLC1A5 |
Target | SLC1A5 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Bovine, Human |
Predicted Reactivity | Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 1.0 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human SLC1A5 |
Protein Sequence | Synthetic peptide located within the following region: FGVALRKLGPEGELLIRFFNSFNEATMVLVSWIMWYAPVGIMFLVAGKIV |
UniProt ID | Q71UA6 |
MW | 57 kDa |
Tested applications | IHC, WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | R16, AAAT, ATBO, M7V1, RDRC, ASCT2, M7VS1 |
Note | For research use only |
NCBI | NP_005619 |
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 5 ug/ml of the antibody was used in this experiment. The canonical isoform of 56 kDa is present as well as a second isoform around 33-36 kDa.
Sample Tissue: Human 293T, Antibody Dilution: 1.0 ug/ml.
Positive control (+): 293T (2T), Negative control (-): Human liver (LI), Antibody concentration: 3 ug/ml.
Rabbit Anti-SLC1A5 Antibody, Paraffin Embedded Tissue: Human Kidney, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.
WB Suggested Anti-SLC1A5 Antibody Titration: 2.5 ug/ml, Positive Control: Jurkat cell lysate. SLC1A5 is supported by BioGPS gene expression data to be expressed in Jurkat.
WB | |
Human | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |