You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb579076 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to SLC19A1 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Human |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human SLC19A1 |
Concentration | 1.0 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 65 kDa |
Target | SLC19A1 |
UniProt ID | P41440 |
Protein Sequence | Synthetic peptide located within the following region: MVPSSPAVEKQVPVEPGPDPELRSWRHLVCYLCFYGFMAQIRPGESFITP |
NCBI | NP_919231 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | RFC, CHMD, FOLT, IFC1, REFC, RFC1, hRFC, IFC-1, ME Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. Recommended dilution is 1-3 ug/ml for this antibody.
Human kidney
WB Suggested Anti-SLC19A1 Antibody Titration: 5.0 ug/ml, Positive Control: Jurkat cell lysate. SLC19A1 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells.
ICC, IF | |
Mouse, Rat | |
Mouse | |
Rabbit | |
Polyclonal | |
APC |