You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb327516 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to MOT5 |
Target | SLC16A4 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Human |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human SLC16A4 |
Protein Sequence | Synthetic peptide located within the following region: KREGKVQPYTKTLDGGWGWMIVIHFFLVNVFVMGMTKTFAIFFVVFQEEF |
UniProt ID | O15374 |
MW | 54 kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | anti MCT4 antibody, anti MCT5 antibody |
Note | For research use only |
NCBI | NP_001188475.1 |
Sample Tissue: Human 293T Whole Cell, Antibody Dilution: 1.0 ug/mL.
ICC, IF | |
Bovine, Equine, Human, Mouse, Porcine, Rat, Sheep | |
Rabbit | |
Polyclonal | |
PE |
ICC, IF | |
Bovine, Equine, Human, Mouse, Porcine, Rat, Sheep | |
Rabbit | |
Polyclonal | |
APC |
ICC, IF | |
Bovine, Equine, Human, Mouse, Porcine, Rat, Sheep | |
Rabbit | |
Polyclonal | |
PerCP/Cy5.5 |
ICC, IF | |
Bovine, Equine, Human, Mouse, Porcine, Rat, Sheep | |
Rabbit | |
Polyclonal | |
PerCP |