Cart summary

You have no items in your shopping cart.

SLC13A4 Rabbit Polyclonal Antibody (Biotin)

SLC13A4 Rabbit Polyclonal Antibody (Biotin)

Catalog Number: orb2090371

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2090371
CategoryAntibodies
DescriptionSLC13A4 Rabbit Polyclonal Antibody (Biotin)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsWB
Predicted ReactivityBovine, Canine, Equine, Human, Mouse, Rat
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of Human SLC13A4
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationBiotin
MW69kDa
UniProt IDQ9UKG4
Protein SequenceSynthetic peptide located within the following region: NPIKTANQHQGKKQHPSQEKPQVLTPSPRKQKLNRKYRSHHDQMICKCLS
NCBINP_036582
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
Alternative namesNAS2, SUT1, SUT-1
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.