SLC13A2 Rabbit Polyclonal Antibody

• Catalog Number: orb578967
• Category: Antibodies
• Description: Rabbit polyclonal antibody to SLC13A2
• Target: SLC13A2
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Guinea pig, Porcine, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SLC13A2
• Protein Sequence: Synthetic peptide located within the following region: PNAKGESMVSDGTVAIFIGIIMFIIPSKFPGLTQDPENPGKLKAPLGLLD
• UniProt ID: Q13183
• MW: 64 kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: NaCT, NADC1, SDCT1, NaDC-1
• Note: For research use only
• NCBI: NP_003975

25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment.

Anti-SLC13A2 antibody IHC of human small intestine. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. SLC13A2 Antibody orb578967 concentration 5 ug/ml.

WB Suggested Anti-SLC13A2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: 721_B cell lysate.