SLC12A4 Rabbit Polyclonal Antibody

• Catalog Number: orb330348
• Category: Antibodies
• Description: Rabbit polyclonal antibody to SLC12A4
• Target: SLC12A4
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Sheep
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SLC12A4
• Protein Sequence: Synthetic peptide located within the following region: MPHFTVVPVDGPRRGDYDNLEGLSWVDYGERAELDDSDGHGNHRESSPFL
• UniProt ID: Q9UP95
• MW: 121kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti FLJ40489 antibody, anti KCC1 antibody
• Note: For research use only
• NCBI: NP_005063

WB Suggested Anti-SLC12A4 Antibody Titration: 0.2-1 ug/mL, Positive Control: PANC1 cell lysate, There is BioGPS gene expression data showing that SLC12A4 is expressed in PANC1.