Availability

  • Request Lead Time
  • In stock and ready for quick dispatch
  • Usually dispatched within 1 - 2 weeks
Shipping Destination:
United States
Shipping charges:
Freight/Packing: $34.00

Need Help?

Ask a Question Support@biorbyt.com
Product Overview
Product Name SLC12A2 antibody
Catalog Number orb330344
Species/HostRabbit
ReactivityCanine, Equine, Guinea pig, Human, Mouse, Porcine, Rat, Zebrafish
ConjugationUnconjugated
Tested applicationsWB
Immunogen Synthetic peptide located within the following region: IIAFEEIIEPYRLHEDDKEQDIADKMKEDEPWRITDNELELYKTKTYRQI
Target SLC12A2
Alternative Names
Product Properties
Form/Appearance Liquid: supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Storage Store at 4°C for up to two weeks. For long term storage, aliquot and store at -20°C, avoid freeze/thaw cycles.
Note For research use only.
Isotype IgG
ClonalityPolyclonal
Purity Protein A purified
MW 131 kDa
Uniprot ID P55011
NCBI NM_001046; NP_001037
Entrez 6558
Product Description

Rabbit polyclonal antibody to SLC12A2

Validation Images
Western blot analysis of DLD1 cell lysate tissue using SLC12A2 antibody
Western blot analysis of DLD1 cell lysate tissue using SLC12A2 antibody
Reviews
Write Your Own Review
You're reviewing:SLC12A2 antibody - orb330344
Your Rating