SLC12A2 Rabbit Polyclonal Antibody

• Catalog Number: orb330344
• Category: Antibodies
• Description: Rabbit polyclonal antibody to SLC12A2
• Target: SLC12A2
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Protein A purified
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human SLC12A2
• Protein Sequence: Synthetic peptide located within the following region: IIAFEEIIEPYRLHEDDKEQDIADKMKEDEPWRITDNELELYKTKTYRQI
• UniProt ID: P55011
• MW: 131kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti BSC antibody, anti BSC2 antibody, anti MGC104
• Research Area: Cell Biology, Protein Biochemistry, Signal Transdu
• Note: For research use only
• NCBI: NP_001037
• Expiration Date: 12 months from date of receipt.

Sample Tissue: Human Jurkat, Antibody Dilution: 1.0 ug/mL.

WB Suggested Anti-SLC12A2 Antibody Titration: 5.0 ug/mL, ELISA Titer: 1:1562500, Positive Control: DLD1 cell lysate, SLC12A2 is supported by BioGPS gene expression data to be expressed in DLD1.