SLC12A2 Rabbit Polyclonal Antibody

SKU: orb330344

Description

SLC12A2 Rabbit Polyclonal Antibody is an unconjugated, Protein A purified antibody for the detection of SLC12A2. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the C terminal region of human SLC12A2. This antibody reacts with Human samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Zebrafish. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Signal Transduction

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human SLC12A2
• Target: SLC12A2
• Protein Sequence: Synthetic peptide located within the following region: IIAFEEIIEPYRLHEDDKEQDIADKMKEDEPWRITDNELELYKTKTYRQI
• Molecular Weight: 131kDa
• Purification: Protein A purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti BSC antibody, anti BSC2 antibody, anti MGC104233 antibody, anti NKCC1 antibody

Quick Database Links

Gene Symbol

SLC12A2

UniProt

P55011

RefSeq (Protein):NP_001037