You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb578921 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to SLC11A2 |
Target | SLC11A2 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Rat |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human SLC11A2 |
Protein Sequence | Synthetic peptide located within the following region: VLGPEQKMSDDSVSGDHGESASLGNINPAYSNPSLSQSPGDSEEYFATYF |
UniProt ID | P49281 |
MW | 61kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | DCT1, DMT1, AHMIO1, NRAMP2 |
Note | For research use only |
NCBI | NP_000608 |
Sample Tissue: Human Fetal Lung, Antibody Dilution: 1.0 ug/ml.
WB Suggested Anti-SLC11A2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: HepG2 cell lysate. SLC11A2 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells.
IF, IHC-Fr, IHC-P, WB | |
Bovine | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IH, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IF, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF | |
Bovine | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
PE/Cy5 |