Cart summary

You have no items in your shopping cart.

SIDT2 Rabbit Polyclonal Antibody

SKU: orb577445

Description

Rabbit polyclonal antibody to SIDT2

Research Area

Cell Biology

Images & Validation

Tested ApplicationsWB
ReactivityHuman
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human SIDT2
TargetSIDT2
Protein SequenceSynthetic peptide located within the following region: LNKQKGAPLLFVVRQKEAVVSFQVPLILRGMFQRKYLYQKVERTLCQPPT
Molecular Weight94 kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

CGI-40

Similar Products

  • SIDT2 Rabbit Polyclonal Antibody [orb186138]

    WB

    Bovine, Canine, Equine, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish

    Human

    Rabbit

    Polyclonal

    Unconjugated

    200 μl, 50 μl, 100 μl
  • SIDT2 Rabbit Polyclonal Antibody [orb1880477]

    WB

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    200 μl, 100 μl, 50 μl, 30 μl
  • SIDT2 Rabbit Polyclonal Antibody (HRP) [orb2126231]

    WB

    Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

    Rabbit

    Polyclonal

    HRP

    100 μl
  • SIDT2 Rabbit Polyclonal Antibody (FITC) [orb2126232]

    WB

    Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

    Rabbit

    Polyclonal

    FITC

    100 μl
  • SIDT2 Rabbit Polyclonal Antibody (Biotin) [orb2126233]

    WB

    Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

    Rabbit

    Polyclonal

    Biotin

    100 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

SIDT2 Rabbit Polyclonal Antibody

25 ug of the indicated Human whole cell extracts was loaded onto a 6-18% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment.

SIDT2 Rabbit Polyclonal Antibody

Sample Type: HepG2, Antibody Dilution: 1.0 ug/ml. SIDT2 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells.

SIDT2 Rabbit Polyclonal Antibody

Sample Type: Human Fetal Brain, Antibody Dilution: 1.0 ug/ml.

SIDT2 Rabbit Polyclonal Antibody

Sample Type: Human Adult Placenta, Antibody Dilution: 1.0 ug/ml.

SIDT2 Rabbit Polyclonal Antibody

Sample Tissue: Human Fetal Liver, Antibody Dilution: 1.0 ug/ml.

SIDT2 Rabbit Polyclonal Antibody

Sample Tissue: Human HepG2 Whole Cell, Antibody Dilution: 1 ug/ml.

SIDT2 Rabbit Polyclonal Antibody

Sample Type: 721_B, Antibody Dilution: 1.0 ug/ml. SIDT2 is supported by BioGPS gene expression data to be expressed in 721_B.

SIDT2 Rabbit Polyclonal Antibody

Rabbit Anti-SIDT2 antibody, Catalog Number: orb577445, Paraffin Embedded Tissue: Human Placenta cell, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

SIDT2 Rabbit Polyclonal Antibody

Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 0.5, 5, and 50 ug/ml. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for either two or three concentrations were averaged and results and standard deviation are shown.

SIDT2 Rabbit Polyclonal Antibody

WB Suggested Anti-SIDT2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: Hela cell lysate.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

SIDT2 Rabbit Polyclonal Antibody (orb577445)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 600.00
DispatchUsually dispatched within 3-7 working days
Bulk Enquiry