You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb589070 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to SHC2 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Human |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human SHC2 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 62 kDa |
Target | SHC2 |
UniProt ID | P98077 |
Protein Sequence | Synthetic peptide located within the following region: LRDACSLPWDVGSTGTAPPGDGYVQADARGPPDHEEHLYVNTQGLDAPEP |
NCBI | NP_036567.2 |
Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -2°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | SCK, SLI, SHCB Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
IH, WB | |
Human, Mouse, Primate, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating