You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb582338 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to SH3KBP1 |
Target | SH3KBP1 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human SH3KBP1 |
Protein Sequence | Synthetic peptide located within the following region: TGMFPSNFIKELSGESDELGISQDEQLSKSSLRETTGSESDGGDSSSTKS |
UniProt ID | Q5JPT5 |
MW | 68 |
Tested applications | IHC, WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | HSB1, AGMX2, CIN85, GIG10, HSB-1, IMD61, MIG18, CD Read more... |
Note | For research use only |
NCBI | NP_001019837 |
Rabbit Anti-SH3KBP1 Antibody, Catalog Number: orb582338, Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue, Observed Staining: Cytoplasmic, plasma membrane, Primary Antibody Concentration: 1:100, Other Working Concentrations: N/A, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.
WB Suggested Anti-SH3KBP1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Jurkat cell lysate.
WB | |
Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit | |
Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, WB | |
Bovine, Canine, Equine, Mouse, Rat, Sheep | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, WB | |
Bovine, Canine, Equine, Mouse, Rat, Sheep | |
Human | |
Rabbit | |
Polyclonal | |
Biotin |