SH3BP2 Rabbit Polyclonal Antibody

• Catalog Number: orb583208
• Category: Antibodies
• Description: Rabbit polyclonal antibody to SH3BP2
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Guinea pig, Mouse, Rabbit, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SH3BP2
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 62kDa
• Target: SH3BP2
• UniProt ID: P78314
• Protein Sequence: Synthetic peptide located within the following region: RQPSQADTGGDDSDEDYEKVPLPNSVFVNTTESCEVERLFKATSPRGEPQ
• NCBI: NP_003014
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: 3BP2, CRBM, CRPM, 3BP-2, RES4-23
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Human Liver

Immunohistochemistry with Human kidney lysate tissue at an antibody concentration of 5.0 ug/ml using anti-SH3BP2 antibody (orb583208).

WB Suggested Anti-SH3BP2 Antibody Titration: 1 ug/ml, Positive Control: 721_B cell lysate. SH3BP2 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells.