Cart summary

You have no items in your shopping cart.

SH2D3C Rabbit Polyclonal Antibody (FITC)

SH2D3C Rabbit Polyclonal Antibody (FITC)

Catalog Number: orb2108091

Select Product Size
SizePriceQuantity
100 μl$ 0.00
100 μl Enquire
DispatchUsually dispatched within 5-10 working days
Product Properties
Catalog Numberorb2108091
CategoryAntibodies
DescriptionSH2D3C Rabbit Polyclonal Antibody (FITC)
ClonalityPolyclonal
Species/HostRabbit
ConjugationFITC
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
PurificationAffinity Purified
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human SH2D3C
Protein SequenceSynthetic peptide located within the following region: AGSDYVKFSKEKYILDSSPEKLHKELEEELKLSSTDLRSHAWYHGRIPRE
UniProt IDQ8N5H7
MW77kDa
Tested applicationsWB
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Alternative namesCHAT, NSP3, SHEP1, PRO34088
NoteFor research use only
NCBINP_733745
Expiration Date12 months from date of receipt.
Images
Similar Products
  • NSP3 Rabbit Polyclonal Antibody (FITC) [orb466977]

    ICC,  IF

    Bovine, Canine, Human, Mouse, Rat

    Rabbit

    Polyclonal

    FITC

    100 μl
Reviews

SH2D3C Rabbit Polyclonal Antibody (FITC) (orb2108091)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet