Cart summary

You have no items in your shopping cart.

SGPP2 Rabbit Polyclonal Antibody (Biotin)

SGPP2 Rabbit Polyclonal Antibody (Biotin)

Catalog Number: orb2117683

DispatchUsually dispatched within 5-10 working days
$ 620.00
Catalog Numberorb2117683
CategoryAntibodies
DescriptionSGPP2 Rabbit Polyclonal Antibody (Biotin)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsIHC, WB
Predicted ReactivityBovine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human SGPP2
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationBiotin
MW37kDa
Protein SequenceSynthetic peptide located within the following region: SKPAESLPVIQNIPPLTTYMLVLGLTKFAVGIVLILLVRQLVQNLSLQVL
NCBIXP_001128702
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
Alternative namesSPP2, SPPase2
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.