You have no items in your shopping cart.
You have no items in your shopping cart.
| Catalog Number | orb581936 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to SMS2 |
| Target | SGMS2 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human SGMS2 |
| Protein Sequence | Synthetic peptide located within the following region: KFPLEWWKTGIAFIYAVFNLVLTTVMITVVHERVPPKELSPPLPDKFFDY |
| UniProt ID | Q8NHU3 |
| MW | 42 kDa |
| Tested applications | WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | CDL, SMS2 |
| Research Area | Cell Biology |
| Note | For research use only |
| NCBI | NP_689834 |

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. Multiple isoforms can be identified with this antibody from human and mouse tissues.

25 ug of the indicated Mouse whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. Multiple isoforms can be identified with this antibody from human and mouse tissues.

WB Suggested Anti-SGMS2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Human heart.
IF, IHC-Fr, IHC-P | |
Bovine, Equine, Human, Mouse, Rabbit, Sheep | |
Rat | |
Rabbit | |
Polyclonal | |
Biotin |
WB | |
Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IHC-Fr, IHC-P | |
Bovine, Equine, Human, Mouse, Rabbit, Sheep | |
Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC-Fr, IHC-P | |
Bovine, Equine, Human, Mouse, Rabbit, Sheep | |
Rat | |
Rabbit | |
Polyclonal | |
AP |
IF | |
Bovine, Equine, Human, Mouse, Rabbit, Sheep | |
Rat | |
Rabbit | |
Polyclonal | |
Cy5 |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review