Cart summary

You have no items in your shopping cart.

SGCE Rabbit Polyclonal Antibody (Biotin)

SGCE Rabbit Polyclonal Antibody (Biotin)

Catalog Number: orb2116840

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2116840
CategoryAntibodies
DescriptionSGCE Rabbit Polyclonal Antibody (Biotin)
ClonalityPolyclonal
Species/HostRabbit
ConjugationBiotin
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human SGCE
Protein SequenceSynthetic peptide located within the following region: TVYSIFSKVHSDRNVYPSAGVLFVHVLEREYFKGEFPPYPKPGEISNDPI
UniProt IDB5MDA7
MW52kDa
Tested applicationsIHC, WB
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Alternative namesESG, DYT11, epsilon-SG
NoteFor research use only
NCBINP_001092871
  • SGCE Rabbit Polyclonal Antibody (Biotin) [orb450781]

    IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Canine, Equine, Human, Porcine, Rabbit, Sheep

    Mouse, Rat

    Rabbit

    Polyclonal

    Biotin

    100 μl