SFPQ Rabbit Polyclonal Antibody

• Catalog Number: orb577664
• Category: Antibodies
• Description: Rabbit polyclonal antibody to SFPQ
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Mouse, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SFPQ
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 78kDa
• Target: SFPQ
• UniProt ID: P23246
• Protein Sequence: Synthetic peptide located within the following region: VPGPGPGPKQGPGPGGPKGGKMPGGPKPGGGPGLSTPGGHPKPPHRGGGE
• NCBI: NP_005057
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: PSF, POMP100, PPP1R140
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Lanes: Lane 1: 50 ug Hela Lysate, Primary Antibody Dilution: 1:1000, Secondary Antibody: Anti-rabbit-HRP, Secondary Antibody Dilution: 1:10000, Gene Name: SFPQ, SFPQ is strongly supported by BioGPS gene expression data to be expressed in Human HeLa cells.

Rabbit Anti-SFPQ antibody, Paraffin Embedded Tissue: Human Heart cell Cellular Data: cardiac cell of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

Rabbit Anti-SFPQ Antibody, Paraffin Embedded Tissue: Human Intestine, Cellular Data: Epithelial cells of intestinal villas, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

Rabbit Anti-SFPQ Antibody, Paraffin Embedded Tissue: Human Skin, Cellular Data: Squamous epithelial cells, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

WB Suggested Anti-SFPQ Antibody Titration: 1.25 ug/ml, ELISA Titer: 1:12500, Positive Control: HepG2 cell lysate. SFPQ is strongly supported by BioGPS gene expression data to be expressed in HepG2.