SERPINE1 Rabbit Polyclonal Antibody

• Catalog Number: orb580069
• Category: Antibodies
• Description: Rabbit polyclonal antibody to SERPINE1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Porcine, Rabbit, Rat, Sheep
• Reactivity: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SERPINE1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 43kDa
• Target: SERPINE1
• UniProt ID: P05121
• Protein Sequence: Synthetic peptide located within the following region: VAHLASDFGVRVFQQVAQASKDRNVVFSPYGVASVLAMLQLTTGGETQQQ
• NCBI: NP_000593
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: Anti-Plasminogen Activator Inhibitor-1 antibody, a
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Tissue: Mouse Skeletal Muscle, Antibody dilution: 1 ug/ml.

Sample Tissue: Mouse Skeletal Muscle, Antibody dilution: 1 ug/ml.

SERPINE1 antibody - N-terminal region (orb580069), Catalog Number: orb580069, Formalin Fixed Paraffin Embedded Tissue: Human Bronchial Epithelial Tissue, Observed Staining: Cytoplasm in Human Bronchial Epithelial Tissue, Primary Antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-SERPINE1 Antibody Titration: 0.2-1 ug/ml, Positive Control: Transfected 293T.