SEPT9 antibody

• Catalog Number: orb325685
• Category: Antibodies
• Description: Rabbit polyclonal antibody to SEPT9
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Animal, Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish
• Reactivity: Canine, Equine, Guinea pig, Human, Mouse, Rat, Zebrafish
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human SEPT9(septin 9)
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 37kDa
• Target: SEPT9
• UniProt ID: Q9UHD8
• Protein Sequence: Synthetic peptide located within the following region: HCEFAYLRDLLIRTHMQNIKDITSSIHFEAYRVKRLNEGSSAMANGMEEK
• NCBI: NP_001106968
• Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -2°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti AF17q25 antibody, anti KIAA0991 antibody, ant
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Western blot analysis of HepG2 cell lysate tissue using SEPT9 antibody

Western blot analysis of human Fetal Liver tissue using SEPT9 antibody

Western blot analysis of human Fetal Muscle tissue using SEPT9 antibody