You have no items in your shopping cart.
You have no items in your shopping cart.
| Catalog Number | orb577934 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to SLA |
| Target | SEPSECS |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human SLA/LP |
| Protein Sequence | Synthetic peptide located within the following region: MDSNNFLGNCGVGEREGRVASALVARRHYRFIHGIGRSGDISAVQPKAAG |
| UniProt ID | A1A4F3 |
| MW | 56 kDa |
| Tested applications | IHC, WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | LP, SLA, PCH2D, SLA/LP |
| Research Area | Molecular Biology |
| Note | For research use only |
| NCBI | NP_722547 |

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. Peptide is contained within a 65 kDa, 56 kDa, 54 kDa, 52 kDa, and 38 kDa isoforms of the protein. Protein may also be modified by phosphorylation.

Rabbit Anti-SLA/LP Antibody, Paraffin Embedded Tissue: Human Kidney, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

WB Suggested Anti-SLA Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Jurkat cell lysate.
IHC, WB | |
Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IHC-Fr, IHC-P, WB | |
Bovine, Canine, Human, Rabbit, Sheep | |
Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IP, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review