You have no items in your shopping cart.
SENP6 Rabbit Polyclonal Antibody
Description
Research Area
Images & Validation
−| Tested Applications | WB |
|---|---|
| Reactivity | Human, Rat |
| Predicted Reactivity | Bovine, Equine, Porcine |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human SENP6 |
| Target | SENP6 |
| Protein Sequence | Synthetic peptide located within the following region: MNLANWFPPPRMRTKREEIRNIILKLQEDQSKEKRKHKDTYSTEAPLGEG |
| Molecular Weight | 125kDa |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−SENP6 Rabbit Polyclonal Antibody [orb234963]
IHC, WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
30 μl, 100 μl, 200 μl, 50 μlSenp6 Rabbit Polyclonal Antibody [orb581135]
WB
Bovine, Canine, Equine, Human, Porcine, Rabbit, Rat
Mouse
Rabbit
Polyclonal
Unconjugated
100 μl

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Sample Type: 1.Rat Testis cells (200 ug), Primary dilution: 1:1000, Secondary Antibody: alkaline phosphatase-conjugated anti-rabbit, Secondary dilution: 1:1000.

WB Suggested Anti-SENP6 Antibody Titration: 0.2-1 ug/ml, Positive Control: 721_B cell lysate. SENP6 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells.
Quick Database Links
UniProt Details
−NCBI Reference Sequences
−| Protein | NP_001093879 |
|---|
Documents Download
Request a Document
SENP6 Rabbit Polyclonal Antibody (orb581136)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review





