SEMA4F Rabbit Polyclonal Antibody

• Catalog Number: orb579783
• Category: Antibodies
• Description: Rabbit polyclonal antibody to SEMA4F
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the n terminal region of human SEMA4F
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 67kDa
• Target: SEMA4F
• UniProt ID: O95754
• Protein Sequence: Synthetic peptide located within the following region: PFSGERPRRIDWMVPEAHRQNCRKKGKKEGDLGGRKTLQQRWTTFLKADL
• NCBI: AAH18361
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: S4F, SEMAM, SEMAW, M-SEMA, PRO2353, m-Sema-M
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

human cell line A431, Primary antibody dilution and incubation time: 1:600, 4 degree overnight. Secondary antibody used and dilution and incubation time: 1:3000, RT 2 hours.

Lanes: 1. A431 cell lysate + control siRNA 2. A431 cell lysate + SEMA4F siRNA, Primary Antibody dilution: 1:600, Secondary Antibody: Donkey Anti-rabbit HRP, Secondary Antibody dilution: 1:3000, Gene Name: SEMA4F.

Lanes: 1. Untransfected MIA-PACA2 cell lysate, 2. Untransfected MIA-PACA2 cell lysate, 3. Untransfected MIA-PACA2 cell lysate, 4. hSEMA4F transfected MIA-PACA2 cell lysate, 5. Untransfected MIA-PACA2 cell lysate, 6. hSEMA4F transfected MIA-PACA2 cell lysate, Primary Antibody dilution: 1:600, Secondary Antibody: Donkey Anti-rabbit HRP, Secondary Antibody dilution: 1:3000, Gene Name: SEMA4F.

WB Suggested Anti-SEMA4F Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Transfected 293T.