Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

SEMA4F Rabbit Polyclonal Antibody

SKU: orb579783

Description

SEMA4F Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of SEMA4F. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the n terminal region of human SEMA4F. This antibody reacts with Human samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Neuroscience

Images & Validation

Tested ApplicationsWB
ReactivityHuman
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the n terminal region of human SEMA4F
TargetSEMA4F
Protein SequenceSynthetic peptide located within the following region: PFSGERPRRIDWMVPEAHRQNCRKKGKKEGDLGGRKTLQQRWTTFLKADL
Molecular Weight67kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

S4F, SEMAM, SEMAW, M-SEMA, PRO2353, m-Sema-M

Similar Products

  • SEMA4F Rabbit Polyclonal Antibody [orb1402101]

    ELISA,  FC,  ICC,  IF,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • SEMA4F Rabbit Polyclonal Antibody [orb631059]

    ELISA,  IP,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μg, 100 μg
  • SEMA4F Rabbit Polyclonal Antibody [orb158360]

    ELISA,  ICC,  IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Canine, Equine, Human, Mouse, Rat

    Human

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • SEMA4F Rabbit Polyclonal Antibody [orb579782]

    WB

    Bovine, Canine, Equine, Guinea pig, Mouse, Rat

    Human

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
  • SEMA4F Rabbit Polyclonal Antibody (RBITC) [orb1012476]

    ICC,  IF

    Bovine, Canine, Equine, Human, Mouse, Rat

    Rabbit

    Polyclonal

    RBITC

    100 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

SEMA4F Rabbit Polyclonal Antibody

human cell line A431, Primary antibody dilution and incubation time: 1:600, 4 degree overnight. Secondary antibody used and dilution and incubation time: 1:3000, RT 2 hours.

SEMA4F Rabbit Polyclonal Antibody

Lanes: 1. A431 cell lysate + control siRNA 2. A431 cell lysate + SEMA4F siRNA, Primary Antibody dilution: 1:600, Secondary Antibody: Donkey Anti-rabbit HRP, Secondary Antibody dilution: 1:3000, Gene Name: SEMA4F.

SEMA4F Rabbit Polyclonal Antibody

Lanes: 1. Untransfected MIA-PACA2 cell lysate, 2. Untransfected MIA-PACA2 cell lysate, 3. Untransfected MIA-PACA2 cell lysate, 4. hSEMA4F transfected MIA-PACA2 cell lysate, 5. Untransfected MIA-PACA2 cell lysate, 6. hSEMA4F transfected MIA-PACA2 cell lysate, Primary Antibody dilution: 1:600, Secondary Antibody: Donkey Anti-rabbit HRP, Secondary Antibody dilution: 1:3000, Gene Name: SEMA4F.

SEMA4F Rabbit Polyclonal Antibody

WB Suggested Anti-SEMA4F Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Transfected 293T.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
RefSeqAAH18361

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

SEMA4F Rabbit Polyclonal Antibody (orb579783)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 3-7 working days
Bulk Enquiry