You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb579783 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to SEMA4F |
Target | SEMA4F |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the n terminal region of human SEMA4F |
Protein Sequence | Synthetic peptide located within the following region: PFSGERPRRIDWMVPEAHRQNCRKKGKKEGDLGGRKTLQQRWTTFLKADL |
UniProt ID | O95754 |
MW | 67kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | S4F, SEMAM, SEMAW, M-SEMA, PRO2353, m-Sema-M |
Note | For research use only |
NCBI | AAH18361 |
human cell line A431, Primary antibody dilution and incubation time: 1:600, 4 degree overnight. Secondary antibody used and dilution and incubation time: 1:3000, RT 2 hours.
Lanes: 1. A431 cell lysate + control siRNA 2. A431 cell lysate + SEMA4F siRNA, Primary Antibody dilution: 1:600, Secondary Antibody: Donkey Anti-rabbit HRP, Secondary Antibody dilution: 1:3000, Gene Name: SEMA4F.
Lanes: 1. Untransfected MIA-PACA2 cell lysate, 2. Untransfected MIA-PACA2 cell lysate, 3. Untransfected MIA-PACA2 cell lysate, 4. hSEMA4F transfected MIA-PACA2 cell lysate, 5. Untransfected MIA-PACA2 cell lysate, 6. hSEMA4F transfected MIA-PACA2 cell lysate, Primary Antibody dilution: 1:600, Secondary Antibody: Donkey Anti-rabbit HRP, Secondary Antibody dilution: 1:3000, Gene Name: SEMA4F.
WB Suggested Anti-SEMA4F Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Transfected 293T.
ELISA, IP, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Guinea pig, Mouse, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, ICC, IF, IHC-Fr, IHC-P, WB | |
Bovine, Canine, Equine, Human, Mouse, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
ICC, IF | |
Bovine, Canine, Equine, Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
PE/Cy5.5 |