You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb583096 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to SELENOP |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Equine |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human SEPP1 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 43 kDa |
Target | SELENOP |
UniProt ID | P49908 |
Protein Sequence | Synthetic peptide located within the following region: LGLALALCLLPSGGTESQDQSSLCKQPPAWSIRDQDPMLNSNGSVTVVAL |
NCBI | NP_001087195 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | SeP, SELP, SEPP, SEPP1 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. The protein may be modified by glycosylation.
WB Suggested Anti-SEPP1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: 293T cell lysate. SEPP1 is supported by BioGPS gene expression data to be expressed in HEK293T.
WB | |
Equine, Human | |
Rabbit | |
Polyclonal | |
Biotin |