You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb327406 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to SEH1 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Human |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Human SEH1 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 39kDa |
Target | SEH1L |
UniProt ID | Q96EE3 |
Protein Sequence | Synthetic peptide located within the following region: FDRTAAVWEEIVGESNDKLRGQSHWVKRTTLVDSRTSVTDVKFAPKHMGL |
NCBI | NP_112493 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti SEH1L antibody, anti SEC13L antibody, anti SE Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Sample Type: 721_B Whole Cell lysates, Antibody Dilution: 1.0 ug/mL.
IF, IHC-Fr, IHC-P | |
Bovine, Canine, Gallus, Human, Mouse, Porcine, Rabbit | |
Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, ICC, IF, IHC-Fr, IHC-P | |
Porcine, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |