Cart summary

You have no items in your shopping cart.

SECTM1 Rabbit Polyclonal Antibody (FITC)

SECTM1 Rabbit Polyclonal Antibody (FITC)

Catalog Number: orb2118123

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2118123
CategoryAntibodies
DescriptionSECTM1 Rabbit Polyclonal Antibody (FITC)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsWB
Predicted ReactivityHuman
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human SECTM1
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationFITC
MW27kDa
UniProt IDQ8WVN6
Protein SequenceSynthetic peptide located within the following region: ARDSHAGLYMWHLVGHQRNNRQVTLEVSGAEPQSAPDTGFWPVPAVVTAV
NCBINP_002995
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
Alternative namesK12, SECTM
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.